MFNG polyclonal antibody (A01)
  • MFNG polyclonal antibody (A01)

MFNG polyclonal antibody (A01)

Ref: AB-H00004242-A01
MFNG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MFNG.
Información adicional
Size 50 uL
Gene Name MFNG
Gene Alias -
Gene Description MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq WASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MFNG (NP_002396, 214 a.a. ~ 291 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4242

Enviar uma mensagem


MFNG polyclonal antibody (A01)

MFNG polyclonal antibody (A01)