MFI2 purified MaxPab mouse polyclonal antibody (B01P)
  • MFI2 purified MaxPab mouse polyclonal antibody (B01P)

MFI2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004241-B01P
MFI2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MFI2 protein.
Información adicional
Size 50 ug
Gene Name MFI2
Gene Alias CD228|FLJ38863|MAP97|MGC4856|MTF1
Gene Description antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDESPSRRQTWTRSEEEEGE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MFI2 (NP_201573.1, 1 a.a. ~ 302 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4241

Enviar uma mensagem


MFI2 purified MaxPab mouse polyclonal antibody (B01P)

MFI2 purified MaxPab mouse polyclonal antibody (B01P)