MFAP3 monoclonal antibody (M01), clone 1C7
  • MFAP3 monoclonal antibody (M01), clone 1C7

MFAP3 monoclonal antibody (M01), clone 1C7

Ref: AB-H00004238-M01
MFAP3 monoclonal antibody (M01), clone 1C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MFAP3.
Información adicional
Size 100 ug
Gene Name MFAP3
Gene Alias DKFZp586F0219
Gene Description microfibrillar-associated protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGAYENCQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MFAP3 (NP_005918, 262 a.a. ~ 362 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4238
Clone Number 1C7
Iso type IgG2b Kappa

Enviar uma mensagem


MFAP3 monoclonal antibody (M01), clone 1C7

MFAP3 monoclonal antibody (M01), clone 1C7