MFAP2 purified MaxPab mouse polyclonal antibody (B01P)
  • MFAP2 purified MaxPab mouse polyclonal antibody (B01P)

MFAP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004237-B01P
MFAP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MFAP2 protein.
Información adicional
Size 50 ug
Gene Name MFAP2
Gene Alias MAGP|MAGP-1|MAGP1
Gene Description microfibrillar-associated protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MFAP2 (NP_002394.1, 1 a.a. ~ 183 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4237

Enviar uma mensagem


MFAP2 purified MaxPab mouse polyclonal antibody (B01P)

MFAP2 purified MaxPab mouse polyclonal antibody (B01P)