MFAP2 polyclonal antibody (A01)
  • MFAP2 polyclonal antibody (A01)

MFAP2 polyclonal antibody (A01)

Ref: AB-H00004237-A01
MFAP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MFAP2.
Información adicional
Size 50 uL
Gene Name MFAP2
Gene Alias MAGP|MAGP-1|MAGP1
Gene Description microfibrillar-associated protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MFAP2 (NP_002394, 76 a.a. ~ 158 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4237

Enviar uma mensagem


MFAP2 polyclonal antibody (A01)

MFAP2 polyclonal antibody (A01)