MEOX1 monoclonal antibody (M04), clone 1D10
  • MEOX1 monoclonal antibody (M04), clone 1D10

MEOX1 monoclonal antibody (M04), clone 1D10

Ref: AB-H00004222-M04C
MEOX1 monoclonal antibody (M04), clone 1D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MEOX1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name MEOX1
Gene Alias MOX1
Gene Description mesenchyme homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MEOX1 (NP_004518.1, 165 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 4222
Clone Number 1D10
Iso type IgG2a Kappa

Enviar uma mensagem


MEOX1 monoclonal antibody (M04), clone 1D10

MEOX1 monoclonal antibody (M04), clone 1D10