MEOX1 monoclonal antibody (M01), clone 1A10
  • MEOX1 monoclonal antibody (M01), clone 1A10

MEOX1 monoclonal antibody (M01), clone 1A10

Ref: AB-H00004222-M01
MEOX1 monoclonal antibody (M01), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MEOX1.
Información adicional
Size 100 ug
Gene Name MEOX1
Gene Alias MOX1
Gene Description mesenchyme homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MEOX1 (NP_004518.1, 165 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4222
Clone Number 1A10
Iso type IgG2a Kappa

Enviar uma mensagem


MEOX1 monoclonal antibody (M01), clone 1A10

MEOX1 monoclonal antibody (M01), clone 1A10