MAP3K3 monoclonal antibody (M10), clone 1H3
  • MAP3K3 monoclonal antibody (M10), clone 1H3

MAP3K3 monoclonal antibody (M10), clone 1H3

Ref: AB-H00004215-M10
MAP3K3 monoclonal antibody (M10), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP3K3.
Información adicional
Size 100 ug
Gene Name MAP3K3
Gene Alias MAPKKK3|MEKK3
Gene Description mitogen-activated protein kinase kinase kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNEANVMLPYSGKEEPVLPVAMTLPLPGRGPRCGTAATEGGSSFVNAVVSVLQVGVTLMLYPVSKLETVCALWALSTPALGLGLGCIEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K3 (AAH10464.1, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4215
Clone Number 1H3
Iso type IgG2a Kappa

Enviar uma mensagem


MAP3K3 monoclonal antibody (M10), clone 1H3

MAP3K3 monoclonal antibody (M10), clone 1H3