MEIS1 polyclonal antibody (A01)
  • MEIS1 polyclonal antibody (A01)

MEIS1 polyclonal antibody (A01)

Ref: AB-H00004211-A01
MEIS1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MEIS1.
Información adicional
Size 50 uL
Gene Name MEIS1
Gene Alias MGC43380
Gene Description Meis homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MEIS1 (NP_002389, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4211

Enviar uma mensagem


MEIS1 polyclonal antibody (A01)

MEIS1 polyclonal antibody (A01)