MEFV polyclonal antibody (A01)
  • MEFV polyclonal antibody (A01)

MEFV polyclonal antibody (A01)

Ref: AB-H00004210-A01
MEFV polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MEFV.
Información adicional
Size 50 uL
Gene Name MEFV
Gene Alias FMF|MEF|MGC126560|MGC126586|TRIM20
Gene Description Mediterranean fever
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MEFV (NP_000234, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4210

Enviar uma mensagem


MEFV polyclonal antibody (A01)

MEFV polyclonal antibody (A01)