MEF2D purified MaxPab mouse polyclonal antibody (B01P) View larger

Mouse polyclonal antibody raised against a full-length human MEF2D protein.

AB-H00004209-B01P

New product

MEF2D purified MaxPab mouse polyclonal antibody (B01P)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name MEF2D
Gene Alias DKFZp686I1536
Gene Description myocyte enhancer factor 2D
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRASEELDGLFRRYGSTVPAPNFAMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MEF2D (NP_005911.1, 1 a.a. ~ 521 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4209

More info

Mouse polyclonal antibody raised against a full-length human MEF2D protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human MEF2D protein.

Mouse polyclonal antibody raised against a full-length human MEF2D protein.