MEF2B MaxPab mouse polyclonal antibody (B02P)
  • MEF2B MaxPab mouse polyclonal antibody (B02P)

MEF2B MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00004207-B02P
MEF2B MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MEF2B protein.
Información adicional
Size 50 ug
Gene Name MEF2B
Gene Alias FLJ32599|FLJ46391|MGC189732|MGC189763|RSRFR2
Gene Description myocyte enhancer factor 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEGGDPALPRPRLYPAAPAMPSPDVVYGALPPPGCDPSGLGEALPAQSRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNPCSTATPGPPLGSFPFLPGGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MEF2B (NP_005910.1, 1 a.a. ~ 365 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4207

Enviar uma mensagem


MEF2B MaxPab mouse polyclonal antibody (B02P)

MEF2B MaxPab mouse polyclonal antibody (B02P)