MDM4 polyclonal antibody (A01)
  • MDM4 polyclonal antibody (A01)

MDM4 polyclonal antibody (A01)

Ref: AB-H00004194-A01
MDM4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MDM4.
Información adicional
Size 50 uL
Gene Name MDM4
Gene Alias DKFZp781B1423|HDMX|MDMX|MGC132766|MRP1
Gene Description Mdm4 p53 binding protein homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MDM4 (NP_002384, 381 a.a. ~ 490 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4194

Enviar uma mensagem


MDM4 polyclonal antibody (A01)

MDM4 polyclonal antibody (A01)