MDK purified MaxPab rabbit polyclonal antibody (D01P)
  • MDK purified MaxPab rabbit polyclonal antibody (D01P)

MDK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004192-D01P
MDK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MDK protein.
Información adicional
Size 100 ug
Gene Name MDK
Gene Alias FLJ27379|MK|NEGF2
Gene Description midkine (neurite growth-promoting factor 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MDK (NP_001012333.1, 1 a.a. ~ 143 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4192

Enviar uma mensagem


MDK purified MaxPab rabbit polyclonal antibody (D01P)

MDK purified MaxPab rabbit polyclonal antibody (D01P)