CD46 monoclonal antibody (M07), clone 2E10
  • CD46 monoclonal antibody (M07), clone 2E10

CD46 monoclonal antibody (M07), clone 2E10

Ref: AB-H00004179-M07
CD46 monoclonal antibody (M07), clone 2E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MCP.
Información adicional
Size 100 ug
Gene Name CD46
Gene Alias MCP|MGC26544|MIC10|TLX|TRA2.10
Gene Description CD46 molecule, complement regulatory protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq EEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD46 (AAH30594, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4179
Clone Number 2E10
Iso type IgG2a Kappa

Enviar uma mensagem


CD46 monoclonal antibody (M07), clone 2E10

CD46 monoclonal antibody (M07), clone 2E10