MCM5 purified MaxPab mouse polyclonal antibody (B01P)
  • MCM5 purified MaxPab mouse polyclonal antibody (B01P)

MCM5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004174-B01P
MCM5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MCM5 protein.
Información adicional
Size 50 ug
Gene Name MCM5
Gene Alias CDC46|MGC5315|P1-CDC46
Gene Description minichromosome maintenance complex component 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEVLQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MCM5 (NP_006730.2, 1 a.a. ~ 734 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4174

Enviar uma mensagem


MCM5 purified MaxPab mouse polyclonal antibody (B01P)

MCM5 purified MaxPab mouse polyclonal antibody (B01P)