MCM4 MaxPab rabbit polyclonal antibody (D01)
  • MCM4 MaxPab rabbit polyclonal antibody (D01)

MCM4 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004173-D01
MCM4 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MCM4 protein.
Información adicional
Size 100 uL
Gene Name MCM4
Gene Alias CDC21|CDC54|MGC33310|P1-CDC21|hCdc21
Gene Description minichromosome maintenance complex component 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQSPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MCM4 (AAH31061.1, 1 a.a. ~ 863 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4173

Enviar uma mensagem


MCM4 MaxPab rabbit polyclonal antibody (D01)

MCM4 MaxPab rabbit polyclonal antibody (D01)