MCM4 polyclonal antibody (A01)
  • MCM4 polyclonal antibody (A01)

MCM4 polyclonal antibody (A01)

Ref: AB-H00004173-A01
MCM4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MCM4.
Información adicional
Size 50 uL
Gene Name MCM4
Gene Alias CDC21|CDC54|MGC33310|P1-CDC21|hCdc21
Gene Description minichromosome maintenance complex component 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MCM4 (AAH31061, 267 a.a. ~ 366 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4173

Enviar uma mensagem


MCM4 polyclonal antibody (A01)

MCM4 polyclonal antibody (A01)