MCL1 polyclonal antibody (A02)
  • MCL1 polyclonal antibody (A02)

MCL1 polyclonal antibody (A02)

Ref: AB-H00004170-A02
MCL1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MCL1.
Información adicional
Size 50 uL
Gene Name MCL1
Gene Alias BCL2L3|EAT|MCL1L|MCL1S|MGC104264|MGC1839|TM
Gene Description myeloid cell leukemia sequence 1 (BCL2-related)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MCL1 (NP_068779, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4170

Enviar uma mensagem


MCL1 polyclonal antibody (A02)

MCL1 polyclonal antibody (A02)