MCF2 purified MaxPab mouse polyclonal antibody (B01P)
  • MCF2 purified MaxPab mouse polyclonal antibody (B01P)

MCF2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004168-B01P
MCF2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MCF2 protein.
Información adicional
Size 50 ug
Gene Name MCF2
Gene Alias DBL
Gene Description MCF.2 cell line derived transforming sequence
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQDIAFLSGGRGKDNAWIITFPENCNFRCIPEEVIAKVLTYLTSIARQNGSDSRFTIILDRRLDTWSSLKISLQKISASFPGNLHLVLVLRPTSFLQRTFTDIGFWFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAERYHLLKNDITAVTKEGKILLTNLEVPDTEGAVSSRLECHRQISGDWQTINKLLTQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MCF2 (AAI60052.1, 1 a.a. ~ 985 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4168

Enviar uma mensagem


MCF2 purified MaxPab mouse polyclonal antibody (B01P)

MCF2 purified MaxPab mouse polyclonal antibody (B01P)