MBNL1 monoclonal antibody (M01C), clone 1D11
  • MBNL1 monoclonal antibody (M01C), clone 1D11

MBNL1 monoclonal antibody (M01C), clone 1D11

Ref: AB-H00004154-M01C
MBNL1 monoclonal antibody (M01C), clone 1D11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MBNL1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name MBNL1
Gene Alias DKFZp686P06174|EXP|EXP35|EXP40|EXP42|KIAA0428|MBNL
Gene Description muscleblind-like (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MBNL1 (AAH50535, 1 a.a. ~ 343 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 4154
Clone Number 1D11
Iso type IgG1 Kappa

Enviar uma mensagem


MBNL1 monoclonal antibody (M01C), clone 1D11

MBNL1 monoclonal antibody (M01C), clone 1D11