MB MaxPab rabbit polyclonal antibody (D01)
  • MB MaxPab rabbit polyclonal antibody (D01)

MB MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004151-D01
MB MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MB protein.
Información adicional
Size 100 uL
Gene Name MB
Gene Alias MGC13548|PVALB
Gene Description myoglobin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MB (NP_005359.1, 1 a.a. ~ 154 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4151

Enviar uma mensagem


MB MaxPab rabbit polyclonal antibody (D01)

MB MaxPab rabbit polyclonal antibody (D01)