MB MaxPab mouse polyclonal antibody (B01P)
  • MB MaxPab mouse polyclonal antibody (B01P)

MB MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004151-B01P
MB MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MB protein.
Información adicional
Size 50 ug
Gene Name MB
Gene Alias MGC13548|PVALB
Gene Description myoglobin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MB (NP_005359.1, 1 a.a. ~ 154 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4151

Enviar uma mensagem


MB MaxPab mouse polyclonal antibody (B01P)

MB MaxPab mouse polyclonal antibody (B01P)