MAZ monoclonal antibody (M03), clone 3B1 View larger

Mouse monoclonal antibody raised against a partial recombinant MAZ.

AB-H00004150-M03

New product

MAZ monoclonal antibody (M03), clone 3B1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name MAZ
Gene Alias PUR1|Pur-1|SAF-1|SAF-2|ZF87|ZNF801|Zif87
Gene Description MYC-associated zinc finger protein (purine-binding transcription factor)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAZ (NP_002374, 332 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4150
Clone Number 3B1
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant MAZ.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant MAZ.

Mouse monoclonal antibody raised against a partial recombinant MAZ.