MATK monoclonal antibody (M05A), clone 2C5
  • MATK monoclonal antibody (M05A), clone 2C5

MATK monoclonal antibody (M05A), clone 2C5

Ref: AB-H00004145-M05A
MATK monoclonal antibody (M05A), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MATK.
Información adicional
Size 200 uL
Gene Name MATK
Gene Alias CHK|CTK|DKFZp434N1212|HHYLTK|HYL|HYLTK|Lsk|MGC1708|MGC2101
Gene Description megakaryocyte-associated tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MATK (NP_647612, 422 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 4145
Clone Number 2C5
Iso type IgG2a Kappa

Enviar uma mensagem


MATK monoclonal antibody (M05A), clone 2C5

MATK monoclonal antibody (M05A), clone 2C5