MARK3 monoclonal antibody (M01), clone 1A10
  • MARK3 monoclonal antibody (M01), clone 1A10

MARK3 monoclonal antibody (M01), clone 1A10

Ref: AB-H00004140-M01
MARK3 monoclonal antibody (M01), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MARK3.
Información adicional
Size 100 ug
Gene Name MARK3
Gene Alias CTAK1|KP78|PAR1A
Gene Description MAP/microtubule affinity-regulating kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MARK3 (NP_002367.4, 402 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4140
Clone Number 1A10
Iso type IgG2b Kappa

Enviar uma mensagem


MARK3 monoclonal antibody (M01), clone 1A10

MARK3 monoclonal antibody (M01), clone 1A10