MARK3 purified MaxPab rabbit polyclonal antibody (D01P)
  • MARK3 purified MaxPab rabbit polyclonal antibody (D01P)

MARK3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004140-D01P
MARK3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MARK3 protein.
Información adicional
Size 100 ug
Gene Name MARK3
Gene Alias CTAK1|KP78|PAR1A
Gene Description MAP/microtubule affinity-regulating kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MARK3 (AAH24773.1, 1 a.a. ~ 729 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4140

Enviar uma mensagem


MARK3 purified MaxPab rabbit polyclonal antibody (D01P)

MARK3 purified MaxPab rabbit polyclonal antibody (D01P)