MAL purified MaxPab mouse polyclonal antibody (B01P)
  • MAL purified MaxPab mouse polyclonal antibody (B01P)

MAL purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004118-B01P
MAL purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MAL protein.
Información adicional
Size 50 ug
Gene Name MAL
Gene Alias -
Gene Description mal, T-cell differentiation protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAL (AAH00458, 1 a.a. ~ 153 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4118

Enviar uma mensagem


MAL purified MaxPab mouse polyclonal antibody (B01P)

MAL purified MaxPab mouse polyclonal antibody (B01P)