MAGOH polyclonal antibody (A01)
  • MAGOH polyclonal antibody (A01)

MAGOH polyclonal antibody (A01)

Ref: AB-H00004116-A01
MAGOH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAGOH.
Información adicional
Size 50 uL
Gene Name MAGOH
Gene Alias MAGOHA
Gene Description mago-nashi homolog, proliferation-associated (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAGOH (NP_002361, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4116

Enviar uma mensagem


MAGOH polyclonal antibody (A01)

MAGOH polyclonal antibody (A01)