MAGEA11 MaxPab rabbit polyclonal antibody (D01)
  • MAGEA11 MaxPab rabbit polyclonal antibody (D01)

MAGEA11 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004110-D01
MAGEA11 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MAGEA11 protein.
Información adicional
Size 100 uL
Gene Name MAGEA11
Gene Alias MAGE-11|MAGE11|MAGEA-11|MGC10511
Gene Description melanoma antigen family A, 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAGEA11 (ENSP00000359445, 1 a.a. ~ 319 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4110

Enviar uma mensagem


MAGEA11 MaxPab rabbit polyclonal antibody (D01)

MAGEA11 MaxPab rabbit polyclonal antibody (D01)