SMAD7 monoclonal antibody (M08), clone 2G2
  • SMAD7 monoclonal antibody (M08), clone 2G2

SMAD7 monoclonal antibody (M08), clone 2G2

Ref: AB-H00004092-M08
SMAD7 monoclonal antibody (M08), clone 2G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMAD7.
Información adicional
Size 100 ug
Gene Name SMAD7
Gene Alias CRCS3|FLJ16482|MADH7|MADH8
Gene Description SMAD family member 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD7 (NP_005895, 160 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4092
Clone Number 2G2
Iso type IgG2a Kappa

Enviar uma mensagem


SMAD7 monoclonal antibody (M08), clone 2G2

SMAD7 monoclonal antibody (M08), clone 2G2