SMAD7 polyclonal antibody (A01)
  • SMAD7 polyclonal antibody (A01)

SMAD7 polyclonal antibody (A01)

Ref: AB-H00004092-A01
SMAD7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMAD7.
Información adicional
Size 50 uL
Gene Name SMAD7
Gene Alias CRCS3|FLJ16482|MADH7|MADH8
Gene Description SMAD family member 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD7 (NP_005895, 160 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4092

Enviar uma mensagem


SMAD7 polyclonal antibody (A01)

SMAD7 polyclonal antibody (A01)