SMAD6 monoclonal antibody (M03), clone 2A6
  • SMAD6 monoclonal antibody (M03), clone 2A6

SMAD6 monoclonal antibody (M03), clone 2A6

Ref: AB-H00004091-M03
SMAD6 monoclonal antibody (M03), clone 2A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMAD6.
Información adicional
Size 100 ug
Gene Name SMAD6
Gene Alias HsT17432|MADH6|MADH7
Gene Description SMAD family member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD6 (NP_005576, 285 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4091
Clone Number 2A6
Iso type IgG2b Kappa

Enviar uma mensagem


SMAD6 monoclonal antibody (M03), clone 2A6

SMAD6 monoclonal antibody (M03), clone 2A6