SMAD5 monoclonal antibody (M11), clone 1C1
  • SMAD5 monoclonal antibody (M11), clone 1C1

SMAD5 monoclonal antibody (M11), clone 1C1

Ref: AB-H00004090-M11
SMAD5 monoclonal antibody (M11), clone 1C1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SMAD5.
Información adicional
Size 100 ug
Gene Name SMAD5
Gene Alias DKFZp781C1895|DKFZp781O1323|Dwfc|JV5-1|MADH5
Gene Description SMAD family member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD5 (NP_005894, 173 a.a. ~ 268 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4090
Clone Number 1C1
Iso type IgG2a Kappa

Enviar uma mensagem


SMAD5 monoclonal antibody (M11), clone 1C1

SMAD5 monoclonal antibody (M11), clone 1C1