SMAD1 monoclonal antibody (M11), clone 4C12
  • SMAD1 monoclonal antibody (M11), clone 4C12

SMAD1 monoclonal antibody (M11), clone 4C12

Ref: AB-H00004086-M11
SMAD1 monoclonal antibody (M11), clone 4C12

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SMAD1.
Información adicional
Size 100 ug
Gene Name SMAD1
Gene Alias BSP1|JV4-1|JV41|MADH1|MADR1
Gene Description SMAD family member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD1 (NP_005891, 176 a.a. ~ 259 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4086
Clone Number 4C12
Iso type IgG2a Kappa

Enviar uma mensagem


SMAD1 monoclonal antibody (M11), clone 4C12

SMAD1 monoclonal antibody (M11), clone 4C12