SMAD1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SMAD1 purified MaxPab rabbit polyclonal antibody (D01P)

SMAD1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004086-D01P
SMAD1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SMAD1 protein.
Información adicional
Size 100 ug
Gene Name SMAD1
Gene Alias BSP1|JV4-1|JV41|MADH1|MADR1
Gene Description SMAD family member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMAD1 (NP_001003688.1, 1 a.a. ~ 465 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4086

Enviar uma mensagem


SMAD1 purified MaxPab rabbit polyclonal antibody (D01P)

SMAD1 purified MaxPab rabbit polyclonal antibody (D01P)