SMAD1 polyclonal antibody (A01)
  • SMAD1 polyclonal antibody (A01)

SMAD1 polyclonal antibody (A01)

Ref: AB-H00004086-A01
SMAD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMAD1.
Información adicional
Size 50 uL
Gene Name SMAD1
Gene Alias BSP1|JV4-1|JV41|MADH1|MADR1
Gene Description SMAD family member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMAD1 (NP_005891, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4086

Enviar uma mensagem


SMAD1 polyclonal antibody (A01)

SMAD1 polyclonal antibody (A01)