MAD2L1 MaxPab mouse polyclonal antibody (B01P)
  • MAD2L1 MaxPab mouse polyclonal antibody (B01P)

MAD2L1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004085-B01P
MAD2L1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MAD2L1 protein.
Información adicional
Size 50 ug
Gene Name MAD2L1
Gene Alias HSMAD2|MAD2
Gene Description MAD2 mitotic arrest deficient-like 1 (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAD2L1 (NP_002349.1, 1 a.a. ~ 205 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4085

Enviar uma mensagem


MAD2L1 MaxPab mouse polyclonal antibody (B01P)

MAD2L1 MaxPab mouse polyclonal antibody (B01P)