MARCKS monoclonal antibody (M04), clone 2H4
  • MARCKS monoclonal antibody (M04), clone 2H4

MARCKS monoclonal antibody (M04), clone 2H4

Ref: AB-H00004082-M04
MARCKS monoclonal antibody (M04), clone 2H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MARCKS.
Información adicional
Size 100 ug
Gene Name MARCKS
Gene Alias 80K-L|FLJ14368|FLJ90045|MACS|PKCSL|PRKCSL
Gene Description myristoylated alanine-rich protein kinase C substrate
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MARCKS (NP_002347, 2 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4082
Clone Number 2H4
Iso type IgG1 Kappa

Enviar uma mensagem


MARCKS monoclonal antibody (M04), clone 2H4

MARCKS monoclonal antibody (M04), clone 2H4