NBR1 monoclonal antibody (M05A), clone 5C3
  • NBR1 monoclonal antibody (M05A), clone 5C3

NBR1 monoclonal antibody (M05A), clone 5C3

Ref: AB-H00004077-M05A
NBR1 monoclonal antibody (M05A), clone 5C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NBR1.
Información adicional
Size 200 uL
Gene Name NBR1
Gene Alias 1A1-3B|KIAA0049|M17S2|MIG19
Gene Description neighbor of BRCA1 gene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 4077
Clone Number 5C3
Iso type IgG2a Kappa

Enviar uma mensagem


NBR1 monoclonal antibody (M05A), clone 5C3

NBR1 monoclonal antibody (M05A), clone 5C3