NBR1 MaxPab rabbit polyclonal antibody (D01)
  • NBR1 MaxPab rabbit polyclonal antibody (D01)

NBR1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004077-D01
NBR1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NBR1 protein.
Información adicional
Size 100 uL
Gene Name NBR1
Gene Alias 1A1-3B|KIAA0049|M17S2|MIG19
Gene Description neighbor of BRCA1 gene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NBR1 (NP_005890.2, 1 a.a. ~ 966 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4077

Enviar uma mensagem


NBR1 MaxPab rabbit polyclonal antibody (D01)

NBR1 MaxPab rabbit polyclonal antibody (D01)