NBR1 polyclonal antibody (A01)
  • NBR1 polyclonal antibody (A01)

NBR1 polyclonal antibody (A01)

Ref: AB-H00004077-A01
NBR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NBR1.
Información adicional
Size 50 uL
Gene Name NBR1
Gene Alias 1A1-3B|KIAA0049|M17S2|MIG19
Gene Description neighbor of BRCA1 gene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4077

Enviar uma mensagem


NBR1 polyclonal antibody (A01)

NBR1 polyclonal antibody (A01)