LUM purified MaxPab mouse polyclonal antibody (B01P)
  • LUM purified MaxPab mouse polyclonal antibody (B01P)

LUM purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004060-B01P
LUM purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LUM protein.
Información adicional
Size 50 ug
Gene Name LUM
Gene Alias LDC|SLRR2D
Gene Description lumican
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LUM (NP_002336, 1 a.a. ~ 338 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4060

Enviar uma mensagem


LUM purified MaxPab mouse polyclonal antibody (B01P)

LUM purified MaxPab mouse polyclonal antibody (B01P)