LTK polyclonal antibody (A01)
  • LTK polyclonal antibody (A01)

LTK polyclonal antibody (A01)

Ref: AB-H00004058-A01
LTK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LTK.
Información adicional
Size 50 uL
Gene Name LTK
Gene Alias TYK1
Gene Description leukocyte receptor tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSSELFLQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHKPPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LTK (NP_002335, 355 a.a. ~ 460 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4058

Enviar uma mensagem


LTK polyclonal antibody (A01)

LTK polyclonal antibody (A01)