LTBP2 polyclonal antibody (A01)
  • LTBP2 polyclonal antibody (A01)

LTBP2 polyclonal antibody (A01)

Ref: AB-H00004053-A01
LTBP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LTBP2.
Información adicional
Size 50 uL
Gene Name LTBP2
Gene Alias C14orf141|LTBP3|MSTP031
Gene Description latent transforming growth factor beta binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LTBP2 (NP_000419, 1709 a.a. ~ 1818 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4053

Enviar uma mensagem


LTBP2 polyclonal antibody (A01)

LTBP2 polyclonal antibody (A01)