LTBP1 polyclonal antibody (A01)
  • LTBP1 polyclonal antibody (A01)

LTBP1 polyclonal antibody (A01)

Ref: AB-H00004052-A01
LTBP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LTBP1.
Información adicional
Size 50 uL
Gene Name LTBP1
Gene Alias MGC163161
Gene Description latent transforming growth factor beta binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LTBP1 (NP_000618, 403 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4052

Enviar uma mensagem


LTBP1 polyclonal antibody (A01)

LTBP1 polyclonal antibody (A01)