LTA monoclonal antibody (M13), clone 2E1
  • LTA monoclonal antibody (M13), clone 2E1

LTA monoclonal antibody (M13), clone 2E1

Ref: AB-H00004049-M13
LTA monoclonal antibody (M13), clone 2E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LTA.
Información adicional
Size 100 ug
Gene Name LTA
Gene Alias LT|TNFB|TNFSF1
Gene Description lymphotoxin alpha (TNF superfamily, member 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen Recombinant Flag/His fusion protein corresponding to amino acids 58-205 of human LTA.
Storage Buffer In PBS, pH 7.2
Gene ID 4049
Clone Number 2E1
Iso type IgG1, kappa
Conjugation Flag/His

Enviar uma mensagem


LTA monoclonal antibody (M13), clone 2E1

LTA monoclonal antibody (M13), clone 2E1