LPL purified MaxPab rabbit polyclonal antibody (D01P)
  • LPL purified MaxPab rabbit polyclonal antibody (D01P)

LPL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004023-D01P
LPL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LPL protein.
Información adicional
Size 100 ug
Gene Name LPL
Gene Alias HDLCQ11|LIPD
Gene Description lipoprotein lipase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LPL (NP_000228.1, 1 a.a. ~ 475 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4023

Enviar uma mensagem


LPL purified MaxPab rabbit polyclonal antibody (D01P)

LPL purified MaxPab rabbit polyclonal antibody (D01P)