LOH11CR2A polyclonal antibody (A01)
  • LOH11CR2A polyclonal antibody (A01)

LOH11CR2A polyclonal antibody (A01)

Ref: AB-H00004013-A01
LOH11CR2A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LOH11CR2A.
Información adicional
Size 50 uL
Gene Name VWA5A
Gene Alias BCSC-1|BCSC1|LOH11CR2A
Gene Description von Willebrand factor A domain containing 5A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LOH11CR2A (NP_938057, 332 a.a. ~ 415 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4013

Enviar uma mensagem


LOH11CR2A polyclonal antibody (A01)

LOH11CR2A polyclonal antibody (A01)