LOH11CR2A polyclonal antibody (A01) View larger

Mouse polyclonal antibody raised against a partial recombinant LOH11CR2A.

AB-H00004013-A01

New product

LOH11CR2A polyclonal antibody (A01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name VWA5A
Gene Alias BCSC-1|BCSC1|LOH11CR2A
Gene Description von Willebrand factor A domain containing 5A
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LOH11CR2A (NP_938057, 332 a.a. ~ 415 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4013

More info

Mouse polyclonal antibody raised against a partial recombinant LOH11CR2A.

Enviar uma mensagem

Mouse polyclonal antibody raised against a partial recombinant LOH11CR2A.

Mouse polyclonal antibody raised against a partial recombinant LOH11CR2A.