View larger
Mouse polyclonal antibody raised against a partial recombinant LOH11CR2A.
AB-H00004013-A01
New product
LOH11CR2A polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | VWA5A |
| Gene Alias | BCSC-1|BCSC1|LOH11CR2A |
| Gene Description | von Willebrand factor A domain containing 5A |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | GSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | LOH11CR2A (NP_938057, 332 a.a. ~ 415 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 4013 |
More info
Mouse polyclonal antibody raised against a partial recombinant LOH11CR2A.