LMX1B polyclonal antibody (A01)
  • LMX1B polyclonal antibody (A01)

LMX1B polyclonal antibody (A01)

Ref: AB-H00004010-A01
LMX1B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LMX1B.
Información adicional
Size 50 uL
Gene Name LMX1B
Gene Alias LMX1.2|MGC138325|MGC142051|NPS1
Gene Description LIM homeobox transcription factor 1, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LMX1B (NP_002307, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4010

Enviar uma mensagem


LMX1B polyclonal antibody (A01)

LMX1B polyclonal antibody (A01)